Lineage for d1y8na2 (1y8n A:177-301)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217156Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1217157Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1217499Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (2 proteins)
  6. 1217505Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 1217506Species Human (Homo sapiens) [TaxId:9606] [160702] (5 PDB entries)
    Uniprot Q15120 177-301
  8. 1217514Domain d1y8na2: 1y8n A:177-301 [144602]
    Other proteins in same PDB: d1y8na1, d1y8nb1
    complexed with k, red

Details for d1y8na2

PDB Entry: 1y8n (more details), 2.6 Å

PDB Description: Crystal structure of the PDK3-L2 complex
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d1y8na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y8na2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
npvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvy
vpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvplrk
idrlf

SCOPe Domain Coordinates for d1y8na2:

Click to download the PDB-style file with coordinates for d1y8na2.
(The format of our PDB-style files is described here.)

Timeline for d1y8na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y8na1
View in 3D
Domains from other chains:
(mouse over for more information)
d1y8nb1