SCOPe 2.08: Domain d1vs8c2: 1vs8 C:61-124

Lineage for d1vs8c2 (1vs8 C:61-124)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d1vs8c2: 1vs8 C:61-124 [144498]
   Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8g1, d1vs8g2, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
   complexed with mg
   complexed with mg
   missing some secondary structures that made up less than one-third of the common domain

Details for d1vs8c2

PDB Entry: 1vs8, 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1vs8c2:

Sequence; same for both SEQRES and ATOM records:

>d1vs8c2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d1vs8c2:

• d1vs8c2 first appeared in SCOP 1.75
  
• d1vs8c2 appears in SCOPe 2.07