Lineage for d1vs8i2 (1vs8 I:1-72)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946692Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2946705Domain d1vs8i2: 1vs8 I:1-72 [144507]
    Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8g1, d1vs8g2, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
    complexed with mg
    complexed with mg

Details for d1vs8i2

PDB Entry: 1vs8 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1vs8i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs8i2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d1vs8i2:

Click to download the PDB-style file with coordinates for d1vs8i2.
(The format of our PDB-style files is described here.)

Timeline for d1vs8i2: