Lineage for d1vs8g2 (1vs8 G:82-176)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541179Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2541180Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2541181Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2541182Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2541199Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 2541225Domain d1vs8g2: 1vs8 G:82-176 [144503]
    Other proteins in same PDB: d1vs801, d1vs811, d1vs821, d1vs831, d1vs841, d1vs8c1, d1vs8c2, d1vs8d1, d1vs8e1, d1vs8f1, d1vs8h1, d1vs8h2, d1vs8i1, d1vs8i2, d1vs8j1, d1vs8k1, d1vs8l1, d1vs8m1, d1vs8n1, d1vs8o1, d1vs8p1, d1vs8q1, d1vs8r1, d1vs8s1, d1vs8t1, d1vs8u1, d1vs8v1, d1vs8w1, d1vs8x1, d1vs8y1, d1vs8z1
    complexed with mg
    complexed with mg

Details for d1vs8g2

PDB Entry: 1vs8 (more details), 3.46 Å

PDB Description: Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. this file contains the 50s subunit of one 70s ribosome. the entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1vs8g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vs8g2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

SCOPe Domain Coordinates for d1vs8g2:

Click to download the PDB-style file with coordinates for d1vs8g2.
(The format of our PDB-style files is described here.)

Timeline for d1vs8g2: