Lineage for d1v5ib1 (1v5i B:1-72)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650628Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 1650649Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
    decorated with additional structure
  6. 1650653Protein Proteinase A inhibitor 1, POIA1 [69728] (1 species)
  7. 1650654Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [69729] (2 PDB entries)
  8. 1650655Domain d1v5ib1: 1v5i B:1-72 [144406]
    Other proteins in same PDB: d1v5ia_
    complexed with ca, gol, so4

Details for d1v5ib1

PDB Entry: 1v5i (more details), 1.5 Å

PDB Description: Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
PDB Compounds: (B:) IA-1=serine proteinase inhibitor

SCOPe Domain Sequences for d1v5ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ib1 d.58.3.2 (B:1-72) Proteinase A inhibitor 1, POIA1 {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
sagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqglq
gdlidsieedhv

SCOPe Domain Coordinates for d1v5ib1:

Click to download the PDB-style file with coordinates for d1v5ib1.
(The format of our PDB-style files is described here.)

Timeline for d1v5ib1: