Lineage for d1v5ia_ (1v5i A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1598715Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1598716Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1598717Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1598896Protein automated matches [190073] (11 species)
    not a true protein
  7. 1598897Species Bacillus amyloliquefaciens [TaxId:1390] [186793] (2 PDB entries)
  8. 1598898Domain d1v5ia_: 1v5i A: [119853]
    Other proteins in same PDB: d1v5ib1
    automated match to d1ubna_
    complexed with ca, gol, so4

Details for d1v5ia_

PDB Entry: 1v5i (more details), 1.5 Å

PDB Description: Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
PDB Compounds: (A:) subtilisin bpn'

SCOPe Domain Sequences for d1v5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5ia_ c.41.1.1 (A:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasmvpsetnpfqd
nnshgthvagtvaalnnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd
vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgav
dssnqrasfssvgpeldvmapgvsiqstlpgnkygayngtcmasphvagaaalilskhpn
wtntqvrsslentttklgdsfyygkglinvqaaaq

SCOPe Domain Coordinates for d1v5ia_:

Click to download the PDB-style file with coordinates for d1v5ia_.
(The format of our PDB-style files is described here.)

Timeline for d1v5ia_: