![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families) ![]() |
![]() | Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (3 proteins) decorated with additional structure |
![]() | Protein Proteinase A inhibitor 1, POIA1 [69728] (1 species) |
![]() | Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [69729] (2 PDB entries) |
![]() | Domain d1v5ib1: 1v5i B:1-72 [144406] Other proteins in same PDB: d1v5ia1 complexed with ca, gol, so4; mutant |
PDB Entry: 1v5i (more details), 1.5 Å
SCOP Domain Sequences for d1v5ib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5ib1 d.58.3.2 (B:1-72) Proteinase A inhibitor 1, POIA1 {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]} sagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqglq gdlidsieedhv
Timeline for d1v5ib1: