SCOPe 2.08: Domain d1v5ib1: 1v5i B:1-72

Lineage for d1v5ib1 (1v5i B:1-72)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
   decorated with additional structure

6. Protein Proteinase A inhibitor 1, POIA1 [69728] (1 species)

7. Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [69729] (2 PDB entries)

8. Domain d1v5ib1: 1v5i B:1-72 [144406]
   Other proteins in same PDB: d1v5ia_
   complexed with ca, gol, so4

Details for d1v5ib1

PDB Entry: 1v5i, 1.5 Å

PDB Description: Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'

PDB Compounds: (B:) IA-1=serine proteinase inhibitor

SCOPe Domain Sequences for d1v5ib1:

Sequence; same for both SEQRES and ATOM records:

>d1v5ib1 d.58.3.2 (B:1-72) Proteinase A inhibitor 1, POIA1 {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
sagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqglq
gdlidsieedhv

Timeline for d1v5ib1:

• d1v5ib1 first appeared in SCOP 1.75
  
• d1v5ib1 appears in SCOPe 2.07