Lineage for d2uueb1 (2uue B:181-308)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918296Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 918297Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 918298Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 918311Protein Cyclin A [47956] (2 species)
  7. 918312Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries)
  8. 918339Domain d2uueb1: 2uue B:181-308 [139973]
    Other proteins in same PDB: d2uuea_, d2uuec_
    automatically matched to d1vin_1
    complexed with gvc, mtz

Details for d2uueb1

PDB Entry: 2uue (more details), 2.06 Å

PDB Description: replace: a strategy for iterative design of cyclin binding groove inhibitors
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2uueb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uueb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOPe Domain Coordinates for d2uueb1:

Click to download the PDB-style file with coordinates for d2uueb1.
(The format of our PDB-style files is described here.)

Timeline for d2uueb1: