Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (8 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries) |
Domain d2uued1: 2uue D:181-308 [139976] Other proteins in same PDB: d2uuea_, d2uuec_ automatically matched to d1vin_1 complexed with gvc, mtz |
PDB Entry: 2uue (more details), 2.06 Å
SCOPe Domain Sequences for d2uued1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uued1 a.74.1.1 (D:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
Timeline for d2uued1:
View in 3D Domains from other chains: (mouse over for more information) d2uuea_, d2uueb1, d2uueb2, d2uuec_ |