SCOP 1.75: Domain d2uueb1: 2uue B:181-308

Lineage for d2uueb1 (2uue B:181-308)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries)

8. Domain d2uueb1: 2uue B:181-308 [139973]
   Other proteins in same PDB: d2uuea1, d2uuec1
   automatically matched to d1vin_1
   complexed with gvc, mtz, nh2, pff

Details for d2uueb1

PDB Entry: 2uue, 2.06 Å

PDB Description: replace: a strategy for iterative design of cyclin binding groove inhibitors

PDB Compounds: (B:) cyclin a2

SCOP Domain Sequences for d2uueb1:

Sequence; same for both SEQRES and ATOM records:

>d2uueb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

Timeline for d2uueb1:

• d2uueb1 first appeared in SCOP 1.73
  
• d2uueb1 appears in SCOPe 2.01
  
• d2uueb1 appears in the current release, SCOPe 2.08