![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries) Uniprot P20248 175-432 |
![]() | Domain d2uueb1: 2uue B:175-309 [139973] Other proteins in same PDB: d2uuea_, d2uuec_ automated match to d1h27b1 complexed with gvc, mtz |
PDB Entry: 2uue (more details), 2.06 Å
SCOPe Domain Sequences for d2uueb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uueb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm ehlvlkvltfdlaap
Timeline for d2uueb1:
![]() Domains from other chains: (mouse over for more information) d2uuea_, d2uuec_, d2uued1, d2uued2 |