SCOPe 2.04: Domain d2q44a_: 2q44 A:

Lineage for d2q44a_ (2q44 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein AT1g77540 [118064] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (5 PDB entries)
   Uniprot Q8LEN2

8. Domain d2q44a_: 2q44 A: [139823]
   automated match to d1xo4a_
   complexed with br

Details for d2q44a_

PDB Entry: 2q44, 1.15 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At1g77540

PDB Compounds: (A:) Uncharacterized protein At1g77540

SCOPe Domain Sequences for d2q44a_:

Sequence; same for both SEQRES and ATOM records:

>d2q44a_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplihsevf

Timeline for d2q44a_:

• d2q44a_ first appeared in SCOP 1.73, called d2q44a1
  
• d2q44a_ appears in SCOPe 2.03
  
• d2q44a_ appears in SCOPe 2.05
  
• d2q44a_ appears in the current release, SCOPe 2.08