Lineage for d2q44a_ (2q44 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664399Protein Hypothetical protein AT1g77540 [118064] (1 species)
  7. 1664400Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (5 PDB entries)
    Uniprot Q8LEN2
  8. 1664402Domain d2q44a_: 2q44 A: [139823]
    automated match to d1xo4a_
    complexed with br

Details for d2q44a_

PDB Entry: 2q44 (more details), 1.15 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At1g77540
PDB Compounds: (A:) Uncharacterized protein At1g77540

SCOPe Domain Sequences for d2q44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q44a_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplihsevf

SCOPe Domain Coordinates for d2q44a_:

Click to download the PDB-style file with coordinates for d2q44a_.
(The format of our PDB-style files is described here.)

Timeline for d2q44a_: