![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein AT1g77540 [118064] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (6 PDB entries) Uniprot Q8LEN2 |
![]() | Domain d2q44a_: 2q44 A: [139823] automated match to d1xo4a_ complexed with br missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2q44 (more details), 1.15 Å
SCOPe Domain Sequences for d2q44a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q44a_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh asshsisiipscsyvsdtflprnpswkplihsevf
Timeline for d2q44a_: