Lineage for d1xo4a_ (1xo4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968739Species Arabidopsis thaliana [311193] (1 PDB entry)
  8. 2968740Domain d1xo4a_: 1xo4 A: [303366]
    automated match to d2evna1

Details for d1xo4a_

PDB Entry: 1xo4 (more details)

PDB Description: NMR Solution Structure of At1g77540
PDB Compounds: (A:) Proposed Acetyl Transferase

SCOPe Domain Sequences for d1xo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo4a_ d.108.1.1 (A:) automated matches {Arabidopsis thaliana}
mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi

SCOPe Domain Coordinates for d1xo4a_:

Click to download the PDB-style file with coordinates for d1xo4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xo4a_: