PDB entry 2q44
View 2q44 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At1g77540
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT1G77540, PUTATIVE ACETYLTRANSFERASE, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on
2007-05-31, released
2007-06-19
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-08-10, with a file datestamp of
2011-08-05.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.165
AEROSPACI score: 0.82
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Uncharacterized protein At1g77540
Species: Arabidopsis thaliana [TaxId:3702]
Gene: At1g77540, T5M16.13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d2q44a_ - Heterogens: BR, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2q44A (A:)
sateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
Sequence, based on observed residues (ATOM records): (download)
>2q44A (A:)
ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
asshsisiipscsyvsdtflprnpswkplihsevf