Lineage for d1xo4a_ (1xo4 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609081Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 609082Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 609083Family d.108.1.1: N-acetyl transferase, NAT [55730] (25 proteins)
  6. 609166Protein Hypothetical protein AT1g77540 [118064] (1 species)
  7. 609167Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (2 PDB entries)
  8. 609169Domain d1xo4a_: 1xo4 A: [115679]
    Structural genomics target

Details for d1xo4a_

PDB Entry: 1xo4 (more details)

PDB Description: NMR Solution Structure of At1g77540

SCOP Domain Sequences for d1xo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xo4a_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana)}
mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
afehasshsisiipscsyvsdtflprnpswkplihsevfkssi

SCOP Domain Coordinates for d1xo4a_:

Click to download the PDB-style file with coordinates for d1xo4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xo4a_:

  • d1xo4a_ is new in SCOP 1.71
  • d1xo4a_ does not appear in SCOP 1.73