SCOPe 2.08: Domain d2q3sc2: 2q3s C:2-206

Lineage for d2q3sc2 (2q3s C:2-206)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Hypothetical protein AT5G06450 [102483] (1 species)
   forms a ring-shaped hexamer; function unknown

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)

8. Domain d2q3sc2: 2q3s C:2-206 [139804]
   Other proteins in same PDB: d2q3sa3, d2q3sb3, d2q3sc3, d2q3sd3, d2q3se3, d2q3sf3
   automated match to d1vk0a_

Details for d2q3sc2

PDB Entry: 2q3s, 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g06450

PDB Compounds: (C:) Protein At5g06450

SCOPe Domain Sequences for d2q3sc2:

Sequence, based on SEQRES records:

>d2q3sc2 c.55.3.5 (C:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfpe
tetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedld
llrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekag
peeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records):

>d2q3sc2 c.55.3.5 (C:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgftk
tsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllrenh
glvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeqle
aaaiegwlivnvwdqlsde

Timeline for d2q3sc2:

• d2q3sc2 first appeared in SCOP 1.73, called d2q3sc1
  
• d2q3sc2 appears in SCOPe 2.07