PDB entry 2q3s

View 2q3s on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g06450
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, Protein, homohexamer, At5g06450, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.155
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At5g06450
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450, MHF15.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • expression tag (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d2q3sa2, d2q3sa3
  • Chain 'B':
    Compound: Protein At5g06450
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450, MHF15.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • expression tag (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d2q3sb2, d2q3sb3
  • Chain 'C':
    Compound: Protein At5g06450
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450, MHF15.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • expression tag (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d2q3sc2, d2q3sc3
  • Chain 'D':
    Compound: Protein At5g06450
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450, MHF15.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • expression tag (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d2q3sd2, d2q3sd3
  • Chain 'E':
    Compound: Protein At5g06450
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450, MHF15.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • expression tag (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d2q3se2, d2q3se3
  • Chain 'F':
    Compound: Protein At5g06450
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450, MHF15.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • expression tag (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d2q3sf2, d2q3sf3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q3sA (A:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3sA (A:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q3sB (B:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3sB (B:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q3sC (C:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3sC (C:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q3sD (D:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3sD (D:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2q3sE (E:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3sE (E:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2q3sF (F:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3sF (F:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde