Lineage for d2q3sc1 (2q3s C:1-206)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702398Protein Hypothetical protein AT5G06450 [102483] (1 species)
    forms a ring-shaped hexamer; function unknown
  7. 702399Species Thale-cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries)
  8. 702408Domain d2q3sc1: 2q3s C:1-206 [139804]
    automatically matched to d1vk0a_

Details for d2q3sc1

PDB Entry: 2q3s (more details), 2.1 Å

PDB Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g06450
PDB Compounds: (C:) Protein At5g06450

SCOP Domain Sequences for d2q3sc1:

Sequence, based on SEQRES records: (download)

>d2q3sc1 c.55.3.5 (C:1-206) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
gpeeqleaaaiegwlivnvwdqlsde

Sequence, based on observed residues (ATOM records): (download)

>d2q3sc1 c.55.3.5 (C:1-206) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}
sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
eaaaiegwlivnvwdqlsde

SCOP Domain Coordinates for d2q3sc1:

Click to download the PDB-style file with coordinates for d2q3sc1.
(The format of our PDB-style files is described here.)

Timeline for d2q3sc1: