Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Hypothetical protein AT5G06450 [102483] (1 species) forms a ring-shaped hexamer; function unknown |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102484] (2 PDB entries) |
Domain d2q3sf2: 2q3s F:2-206 [139807] Other proteins in same PDB: d2q3sa3, d2q3sb3, d2q3sc3, d2q3sd3, d2q3se3, d2q3sf3 automated match to d1vk0a_ |
PDB Entry: 2q3s (more details), 2.1 Å
SCOPe Domain Sequences for d2q3sf2:
Sequence, based on SEQRES records: (download)
>d2q3sf2 c.55.3.5 (F:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfpe tetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedld llrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekag peeqleaaaiegwlivnvwdqlsde
>d2q3sf2 c.55.3.5 (F:2-206) Hypothetical protein AT5G06450 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} asfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgftk tsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllrenh glvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeqle aaaiegwlivnvwdqlsde
Timeline for d2q3sf2: