Lineage for d2p9pg_ (2p9p G:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501880Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 1501881Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 1501887Protein automated matches [190348] (1 species)
    not a true protein
  7. 1501888Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)
  8. 1501900Domain d2p9pg_: 2p9p G: [139621]
    Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pb_, d2p9pc_, d2p9pd1, d2p9pd2, d2p9pe_, d2p9pf_
    automated match to d1k8kg_
    complexed with adp, ca

Details for d2p9pg_

PDB Entry: 2p9p (more details), 2.9 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d2p9pg_:

Sequence, based on SEQRES records: (download)

>d2p9pg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d2p9pg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdgevdsclrqgnmtaalqaalknppintksqavkdragsivlk
vlisfkandiekavqsldkngvdllmkyiykgfespsssavllqwhekalaaggvgsivr
vltarktv

SCOPe Domain Coordinates for d2p9pg_:

Click to download the PDB-style file with coordinates for d2p9pg_.
(The format of our PDB-style files is described here.)

Timeline for d2p9pg_: