Lineage for d2p9pg1 (2p9p G:9-151)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647531Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
  5. 647532Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (1 protein)
  6. 647533Protein Arp2/3 complex 16 kDa subunit ARPC5 [69105] (1 species)
  7. 647534Species Cow (Bos taurus) [TaxId:9913] [69106] (10 PDB entries)
  8. 647544Domain d2p9pg1: 2p9p G:9-151 [139621]
    Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pc1, d2p9pd1, d2p9pd2, d2p9pe1, d2p9pf1
    automatically matched to d1k8kg_
    complexed with adp, ca

Details for d2p9pg1

PDB Entry: 2p9p (more details), 2.9 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOP Domain Sequences for d2p9pg1:

Sequence, based on SEQRES records: (download)

>d2p9pg1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d2p9pg1 a.118.13.1 (G:9-151) Arp2/3 complex 16 kDa subunit ARPC5 {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdgevdsclrqgnmtaalqaalknppintksqavkdragsivlk
vlisfkandiekavqsldkngvdllmkyiykgfespsssavllqwhekalaaggvgsivr
vltarktv

SCOP Domain Coordinates for d2p9pg1:

Click to download the PDB-style file with coordinates for d2p9pg1.
(The format of our PDB-style files is described here.)

Timeline for d2p9pg1: