Lineage for d2p9pf_ (2p9p F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685231Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1685314Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1685315Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 1685350Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1685351Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1685366Domain d2p9pf_: 2p9p F: [139620]
    Other proteins in same PDB: d2p9pa1, d2p9pa2, d2p9pb_, d2p9pc_, d2p9pd1, d2p9pd2, d2p9pe_, d2p9pg_
    automated match to d1k8kf_
    complexed with adp, ca

Details for d2p9pf_

PDB Entry: 2p9p (more details), 2.9 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with adp
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d2p9pf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9pf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvli
egsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfht
eqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d2p9pf_:

Click to download the PDB-style file with coordinates for d2p9pf_.
(The format of our PDB-style files is described here.)

Timeline for d2p9pf_: