SCOPe 2.08: Domain d2p9lg_: 2p9l G:

Lineage for d2p9lg_ (2p9l G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family)
   automatically mapped to Pfam PF04699

5. Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)

6. Protein automated matches [190348] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)

8. Domain d2p9lg_: 2p9l G: [139605]
   Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lb_, d2p9lc_, d2p9ld1, d2p9ld2, d2p9le_, d2p9lf_
   automated match to d1k8kg_

Details for d2p9lg_

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d2p9lg_:

Sequence, based on SEQRES records:

>d2p9lg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records):

>d2p9lg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdr
agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
aggvgsivrvltarktv

Timeline for d2p9lg_:

• d2p9lg_ first appeared in SCOP 1.73, called d2p9lg1
  
• d2p9lg_ appears in SCOPe 2.07