SCOPe 2.08: Domain d2p9lf_: 2p9l F:

Lineage for d2p9lf_ (2p9l F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family)

5. Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)

6. Protein ARPC4 (20 kDa subunit) [69647] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
   Uniprot P59998 # 100% sequence identity

8. Domain d2p9lf_: 2p9l F: [139604]
   Other proteins in same PDB: d2p9la1, d2p9la2, d2p9lb_, d2p9lc_, d2p9ld1, d2p9ld2, d2p9le_, d2p9lg_
   automated match to d1k8kf_

Details for d2p9lf_

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d2p9lf_:

Sequence; same for both SEQRES and ATOM records:

>d2p9lf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

Timeline for d2p9lf_:

• d2p9lf_ first appeared in SCOP 1.73, called d2p9lf1
  
• d2p9lf_ appears in SCOPe 2.07