SCOPe 2.08: Domain d2p9la1: 2p9l A:2-160

Lineage for d2p9la1 (2p9l A:2-160)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
   Uniprot P61158

8. Domain d2p9la1: 2p9l A:2-160 [139598]
   Other proteins in same PDB: d2p9lb_, d2p9lc_, d2p9ld1, d2p9ld2, d2p9le_, d2p9lf_, d2p9lg_
   automated match to d1u2va1

Details for d2p9la1

PDB Entry: 2p9l, 2.65 Å

PDB Description: crystal structure of bovine arp2/3 complex

PDB Compounds: (A:) actin-like protein 3

SCOPe Domain Sequences for d2p9la1:

Sequence, based on SEQRES records:

>d2p9la1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d2p9la1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpty
atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe
sfnvpglyiavqavlalaaswtsqvge

Timeline for d2p9la1:

• d2p9la1 first appeared in SCOP 1.73
  
• d2p9la1 appears in SCOPe 2.07