SCOPe 2.07: Domain d2p71a_: 2p71 A:

Lineage for d2p71a_ (2p71 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein automated matches [190345] (4 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [187172] (3 PDB entries)

8. Domain d2p71a_: 2p71 A: [139516]
   automated match to d1gm0a_
   complexed with ihd

Details for d2p71a_

PDB Entry: 2p71, 2.01 Å

PDB Description: bombyx mori pheromone binding protein bound to iodohexadecane

PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d2p71a_:

Sequence; same for both SEQRES and ATOM records:

>d2p71a_ a.39.2.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmd

Timeline for d2p71a_:

• d2p71a_ first appeared in SCOP 1.73, called d2p71a1
  
• d2p71a_ appears in SCOPe 2.06
  
• d2p71a_ appears in the current release, SCOPe 2.08