PDB entry 2p71

View 2p71 on RCSB PDB site
Description: Bombyx mori pheromone binding protein bound to iodohexadecane
Class: attractant
Keywords: alpha-helical, binding pocket, liganded, ATTRACTANT
Deposited on 2007-03-19, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pheromone-binding protein
    Species: Bombyx mori [TaxId:7091]
    Gene: pheromone binding protein
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p71a_
  • Heterogens: IHD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p71A (A:)
    sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
    mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
    eihklnwapsmd