Lineage for d2p71a_ (2p71 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711909Protein automated matches [190345] (4 species)
    not a true protein
  7. 2711926Species Silkworm (Bombyx mori) [TaxId:7091] [187172] (3 PDB entries)
  8. 2711927Domain d2p71a_: 2p71 A: [139516]
    automated match to d1gm0a_
    complexed with ihd

Details for d2p71a_

PDB Entry: 2p71 (more details), 2.01 Å

PDB Description: bombyx mori pheromone binding protein bound to iodohexadecane
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d2p71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p71a_ a.39.2.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmd

SCOPe Domain Coordinates for d2p71a_:

Click to download the PDB-style file with coordinates for d2p71a_.
(The format of our PDB-style files is described here.)

Timeline for d2p71a_: