Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
Protein automated matches [190345] (4 species) not a true protein |
Species Silkworm (Bombyx mori) [TaxId:7091] [187172] (3 PDB entries) |
Domain d2p71a_: 2p71 A: [139516] automated match to d1gm0a_ complexed with ihd |
PDB Entry: 2p71 (more details), 2.01 Å
SCOPe Domain Sequences for d2p71a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p71a_ a.39.2.1 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka eihklnwapsmd
Timeline for d2p71a_: