Lineage for d2ov4a_ (2ov4 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 984755Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 984756Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 984757Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 984851Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (4 species)
    overall structure is similar to TyrRS
  7. 984852Species Bacillus stearothermophilus [TaxId:1422] [52379] (11 PDB entries)
  8. 984858Domain d2ov4a_: 2ov4 A: [139379]
    automated match to d1m83a_
    protein/RNA complex; complexed with anl, aqp, cs, gol

Details for d2ov4a_

PDB Entry: 2ov4 (more details), 2.5 Å

PDB Description: Crystal structure of B. stearothermophilus tryptophanyl tRNA synthetase in complex with adenosine tetraphosphate
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2ov4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ov4a_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgrrr

SCOPe Domain Coordinates for d2ov4a_:

Click to download the PDB-style file with coordinates for d2ov4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ov4a_: