Lineage for d2ov4a1 (2ov4 A:1-328)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693368Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 693458Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (2 species)
    overall structure is similar to TyrRS
  7. 693459Species Bacillus stearothermophilus [TaxId:1422] [52379] (9 PDB entries)
  8. 693471Domain d2ov4a1: 2ov4 A:1-328 [139379]
    automatically matched to d1m83a_
    complexed with anl, aqp, cs, gol

Details for d2ov4a1

PDB Entry: 2ov4 (more details), 2.5 Å

PDB Description: Crystal structure of B. stearothermophilus tryptophanyl tRNA synthetase in complex with adenosine tetraphosphate
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOP Domain Sequences for d2ov4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ov4a1 c.26.1.1 (A:1-328) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgrrr

SCOP Domain Coordinates for d2ov4a1:

Click to download the PDB-style file with coordinates for d2ov4a1.
(The format of our PDB-style files is described here.)

Timeline for d2ov4a1: