PDB entry 2ov4

View 2ov4 on RCSB PDB site
Description: Crystal structure of B. stearothermophilus tryptophanyl tRNA synthetase in complex with adenosine tetraphosphate
Class: ligase
Keywords: aminoacyl-tRNA synthetase, nucleotide binding site, rossmann fold, transition state analog inhibitor, ligase
Deposited on 2007-02-12, released 2007-03-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tryptophanyl-tRNA synthetase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: trpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00953 (0-327)
      • see remark 999 (63)
    Domains in SCOPe 2.01: d2ov4a_
  • Heterogens: CS, AQP, ANL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ov4A (A:)
mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr
laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa
glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg
arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn
llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl
degaekanrvasemvrkmeqamglgrrr