![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species) overall structure is similar to TyrRS |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [52379] (13 PDB entries) |
![]() | Domain d2ov4a_: 2ov4 A: [139379] automated match to d1m83a_ protein/RNA complex; complexed with anl, aqp, cs, gol |
PDB Entry: 2ov4 (more details), 2.5 Å
SCOPe Domain Sequences for d2ov4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ov4a_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} mktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirr laalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsa glltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvg arimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisn llniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvl degaekanrvasemvrkmeqamglgrrr
Timeline for d2ov4a_: