![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
![]() | Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
![]() | Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
![]() | Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
![]() | Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) Uniprot P14121 |
![]() | Domain d2otjw1: 2otj W:1-154 [139339] Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjx1, d2otjy1, d2otjz1 automatically matched to d1ffkt_ complexed with 13t, cd, cl, k, mg, na has additional subdomain(s) that are not in the common domain |
PDB Entry: 2otj (more details), 2.9 Å
SCOPe Domain Sequences for d2otjw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otjw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d2otjw1:
![]() Domains from other chains: (mouse over for more information) d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjx1, d2otjy1, d2otjz1 |