![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
![]() | Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries) Uniprot P20276 |
![]() | Domain d2otja1: 2otj A:91-237 [139316] Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 automatically matched to d1s72a1 complexed with 13t, cd, cl, k, mg, na |
PDB Entry: 2otj (more details), 2.9 Å
SCOPe Domain Sequences for d2otja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otja1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]} gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg kpksisrnappgrkvgdiaskrtgrgg
Timeline for d2otja1:
![]() Domains from other chains: (mouse over for more information) d2otj11, d2otj21, d2otj31, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 |