Lineage for d2otjw1 (2otj W:1-154)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726215Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 726216Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 726217Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 726218Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 726219Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
  8. 726241Domain d2otjw1: 2otj W:1-154 [139339]
    Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1ffkt_
    complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otjw1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOP Domain Sequences for d2otjw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d2otjw1:

Click to download the PDB-style file with coordinates for d2otjw1.
(The format of our PDB-style files is described here.)

Timeline for d2otjw1: