Lineage for d2otjq1 (2otj Q:1-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2783938Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2783939Protein Ribosomal proteins L21e [50108] (1 species)
  7. 2783940Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 2783973Domain d2otjq1: 2otj Q:1-95 [139333]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1ffkn_
    complexed with 13t, cd, cl, k, mg, na

Details for d2otjq1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d2otjq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d2otjq1:

Click to download the PDB-style file with coordinates for d2otjq1.
(The format of our PDB-style files is described here.)

Timeline for d2otjq1: