SCOPe 2.07: Domain d2otjw1: 2otj W:1-154

Lineage for d2otjw1 (2otj W:1-154)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
   Uniprot P14121

8. Domain d2otjw1: 2otj W:1-154 [139339]
   Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjx1, d2otjy1, d2otjz1
   automatically matched to d1ffkt_
   complexed with 13t, cd, cl, k, mg, na

Details for d2otjw1

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d2otjw1:

Sequence; same for both SEQRES and ATOM records:

>d2otjw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d2otjw1:

• d2otjw1 first appeared in SCOP 1.73
  
• d2otjw1 appears in SCOPe 2.06
  
• d2otjw1 appears in the current release, SCOPe 2.08