![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode automatically mapped to Pfam PF02233 |
![]() | Protein Transhydrogenase domain III (dIII) [52485] (3 species) |
![]() | Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries) |
![]() | Domain d2oorc_: 2oor C: [139175] Other proteins in same PDB: d2oora1, d2oora2, d2oorb1, d2oorb2 automated match to d1hzzc_ complexed with gol, nad, txp |
PDB Entry: 2oor (more details), 2.32 Å
SCOPe Domain Sequences for d2oorc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oorc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqam
Timeline for d2oorc_:
![]() Domains from other chains: (mouse over for more information) d2oora1, d2oora2, d2oorb1, d2oorb2 |