SCOP 1.73: Domain d2oorc1: 2oor C:33-202

Lineage for d2oorc1 (2oor C:33-202)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)

8. Domain d2oorc1: 2oor C:33-202 [139175]
   Other proteins in same PDB: d2oora1, d2oora2, d2oorb1, d2oorb2
   automatically matched to d1pnoa_
   complexed with gol, nad, txp

Details for d2oorc1

PDB Entry: 2oor, 2.32 Å

PDB Description: structure of transhydrogenase (di.nad+)2(diii.h2nadph)1 asymmetric complex

PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOP Domain Sequences for d2oorc1:

Sequence; same for both SEQRES and ATOM records:

>d2oorc1 c.31.1.4 (C:33-202) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
agsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagrmp
ghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmpil
dvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqam

Timeline for d2oorc1:

• d2oorc1 is new in SCOP 1.73
  
• d2oorc1 appears in SCOP 1.75
  
• d2oorc1 appears in the current release, SCOPe 2.08, called d2oorc_