Lineage for d2oorc1 (2oor C:33-202)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694382Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 694383Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 694393Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)
  8. 694402Domain d2oorc1: 2oor C:33-202 [139175]
    Other proteins in same PDB: d2oora1, d2oora2, d2oorb1, d2oorb2
    automatically matched to d1pnoa_
    complexed with gol, nad, txp

Details for d2oorc1

PDB Entry: 2oor (more details), 2.32 Å

PDB Description: structure of transhydrogenase (di.nad+)2(diii.h2nadph)1 asymmetric complex
PDB Compounds: (C:) NAD(P) transhydrogenase subunit beta

SCOP Domain Sequences for d2oorc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oorc1 c.31.1.4 (C:33-202) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
agsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvagrmp
ghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygmpil
dvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqam

SCOP Domain Coordinates for d2oorc1:

Click to download the PDB-style file with coordinates for d2oorc1.
(The format of our PDB-style files is described here.)

Timeline for d2oorc1: