Lineage for d2oorb2 (2oor B:1-143,B:327-381)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. Domain d2oorb2: 2oor B:1-143,B:327-381 [139174]
    Other proteins in same PDB: d2oora1, d2oorb1, d2oorc_
    automated match to d1l7db2
    complexed with gol, nad, txp

Details for d2oorb2

PDB Entry: 2oor (more details), 2.32 Å

PDB Description: structure of transhydrogenase (di.nad+)2(diii.h2nadph)1 asymmetric complex
PDB Compounds: (B:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d2oorb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oorb2 c.23.12.2 (B:1-143,B:327-381) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrdgaivhpaltg

SCOPe Domain Coordinates for d2oorb2 are not available.

Timeline for d2oorb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oorb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2oora1, d2oora2, d2oorc_