Lineage for d2od8a1 (2od8 A:1-126)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1040996Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1040997Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 1041062Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 1041084Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 1041092Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (4 PDB entries)
    Uniprot P15873
  8. 1041095Domain d2od8a1: 2od8 A:1-126 [139024]
    automatically matched to d1plq_1

Details for d2od8a1

PDB Entry: 2od8 (more details), 2.8 Å

PDB Description: structure of a peptide derived from cdc9 bound to pcna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d2od8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2od8a1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

SCOPe Domain Coordinates for d2od8a1:

Click to download the PDB-style file with coordinates for d2od8a1.
(The format of our PDB-style files is described here.)

Timeline for d2od8a1: