| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (2 families) ![]() |
| Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins) duplication: consists of two domains of this fold |
| Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (3 PDB entries) |
| Domain d1plq_1: 1plq 1-126 [41388] |
PDB Entry: 1plq (more details), 2.3 Å
SCOP Domain Sequences for d1plq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1plq_1 d.131.1.2 (1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae)}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl
Timeline for d1plq_1: