SCOPe 2.08: Domain d1plqa1: 1plq A:1-126

Lineage for d1plqa1 (1plq A:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
   Uniprot P15873

8. Domain d1plqa1: 1plq A:1-126 [41388]
   CASP1
   complexed with hg

Details for d1plqa1

PDB Entry: 1plq, 2.3 Å

PDB Description: crystal structure of the eukaryotic dna polymerase processivity factor pcna

PDB Compounds: (A:) proliferating cell nuclear antigen (pcna)

SCOPe Domain Sequences for d1plqa1:

Sequence; same for both SEQRES and ATOM records:

>d1plqa1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

Timeline for d1plqa1:

• d1plqa1 first appeared (with stable ids) in SCOP 1.55, called d1plq_1
  
• d1plqa1 appears in SCOPe 2.07