Lineage for d1plq_1 (1plq 1-126)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.131: DNA clamp [55978] (1 superfamily) Superfamily d.131.1: DNA clamp [55979] (2 families) 
Family d.131.1.2: DNA polymerase processivity factor [55983] (3 proteins) 
Protein Prolifirating cell nuclear antigen (PCNA) [55989] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (2 PDB entries) 
Domain d1plq_1: 1plq 1-126 [41388]
Details for d1plq_1
PDB Entry: 1plq (more details), 2.3 Å
PDB Description: crystal structure of the eukaryotic dna polymerase processivity factor pcna
SCOP Domain Sequences for d1plq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1plq_1 d.131.1.2 (1-126) Prolifirating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae)}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl
SCOP Domain Coordinates for d1plq_1:
Click to download the PDB-style file with coordinates for d1plq_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1plq_1:
- d1plq_1 appears in SCOP 1.57
- d1plq_1 appears in the current release, SCOPe 2.08, called d1plqa1
View in 3D
