SCOPe 2.08: Domain d2od8a1: 2od8 A:1-126

Lineage for d2od8a1 (2od8 A:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
   duplication: consists of two domains of this fold

6. Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55990] (8 PDB entries)
   Uniprot P15873

8. Domain d2od8a1: 2od8 A:1-126 [139024]
   automatically matched to d1plq_1

Details for d2od8a1

PDB Entry: 2od8, 2.8 Å

PDB Description: structure of a peptide derived from cdc9 bound to pcna

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d2od8a1:

Sequence; same for both SEQRES and ATOM records:

>d2od8a1 d.131.1.2 (A:1-126) Proliferating cell nuclear antigen (PCNA) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mleakfeeaslfkriidgfkdcvqlvnfqckedgiiaqavddsrvllvsleigveafqey
rcdhpvtlgmdltslskilrcgnntdtltliadntpdsiillfedtkkdriaeyslklmd
idadfl

Timeline for d2od8a1:

• d2od8a1 first appeared in SCOP 1.73
  
• d2od8a1 appears in SCOPe 2.07