SCOPe 2.08: Domain d2o23b2: 2o23 B:1-261

Lineage for d2o23b2 (2o23 B:1-261)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (21 PDB entries)

8. Domain d2o23b2: 2o23 B:1-261 [138885]
   Other proteins in same PDB: d2o23a3, d2o23b3
   automated match to d1u7ta_
   complexed with gol, nad

Details for d2o23b2

PDB Entry: 2o23, 1.2 Å

PDB Description: the structure of wild-type human hadh2 (17beta-hydroxysteroid dehydrogenase type 10) bound to nad+ at 1.2 a

PDB Compounds: (B:) HADH2 protein

SCOPe Domain Sequences for d2o23b2:

Sequence, based on SEQRES records:

>d2o23b2 c.2.1.2 (B:1-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
piardlapigirvmtiapglfgtplltslpekvcnflasqvpfpsrlgdpaeyahlvqai
ienpflngevirldgairmqp

Sequence, based on observed residues (ATOM records):

>d2o23b2 c.2.1.2 (B:1-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaacrsvkglvavitggasglglataerlvgqgasavlldlpnsggeaqakklgnncvf
apadvtsekdvqtalalakgkfgrvdvavncagiavasktynlkkgqthtledfqrvldv
nlmgtfnvirlvagemgqnepdqggqrgviintasvaafegqvgqaaysaskggivgmtl
piardlapigirvmtiapglfgtpllnflasqvpfpsrlgdpaeyahlvqaiienpflng
evirldgairmqp

Timeline for d2o23b2:

• d2o23b2 first appeared in SCOP 1.73, called d2o23b1
  
• d2o23b2 appears in SCOPe 2.07