SCOPe 2.08: Domain d2o06b_: 2o06 B:

Lineage for d2o06b_ (2o06 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein Spermidine synthase [69558] (6 species)
   polyamine aminopropyltransferase

7. Species Human (Homo sapiens) [TaxId:9606] [142590] (5 PDB entries)
   Uniprot P19623 15-300

8. Domain d2o06b_: 2o06 B: [138861]
   automated match to d2o05a1
   complexed with mg, mta, put

Details for d2o06b_

PDB Entry: 2o06, 2 Å

PDB Description: Human spermidine synthase

PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d2o06b_:

Sequence; same for both SEQRES and ATOM records:

>d2o06b_ c.66.1.17 (B:) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}
aairegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvldgviqcte
rdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqceidedviqvs
kkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslfkesyyqlm
ktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgqigfmlcsk
npstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalndvs

Timeline for d2o06b_:

• d2o06b_ first appeared in SCOP 1.73, called d2o06b1
  
• d2o06b_ appears in SCOPe 2.07