Lineage for d2o06a_ (2o06 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893343Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2893348Protein Spermidine synthase [69558] (6 species)
    polyamine aminopropyltransferase
  7. 2893354Species Human (Homo sapiens) [TaxId:9606] [142590] (5 PDB entries)
    Uniprot P19623 15-300
  8. 2893357Domain d2o06a_: 2o06 A: [138860]
    automated match to d2o05a1
    complexed with mg, mta, put

Details for d2o06a_

PDB Entry: 2o06 (more details), 2 Å

PDB Description: Human spermidine synthase
PDB Compounds: (A:) spermidine synthase

SCOPe Domain Sequences for d2o06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o06a_ c.66.1.17 (A:) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]}
dgpaasgpaairegwfretcslwpgqalslqveqllhhrrsryqdilvfrsktygnvlvl
dgviqcterdefsyqemianlplcshpnprkvliigggdggvlrevvkhpsvesvvqcei
dedviqvskkflpgmaigyssskltlhvgdgfefmkqnqdafdviitdssdpmgpaeslf
kesyyqlmktalkedgvlccqgecqwlhldlikemrqfcqslfpvvayayctiptypsgq
igfmlcsknpstnfqepvqpltqqqvaqmqlkyynsdvhraafvlpefarkalndvs

SCOPe Domain Coordinates for d2o06a_:

Click to download the PDB-style file with coordinates for d2o06a_.
(The format of our PDB-style files is described here.)

Timeline for d2o06a_: